zum Directory-modus

Proteinmodellierung (Helix)

Aktuelle Methoden zur Online-Sequenzanalyse

Eine umfassende Sequenzanalyse ist heute durch Online-Dienste möglich. Eine repräsentative Sammlung befindet sich am Schweizer Institut für Bioinformatik unter www.expasy.ch (Expert Protein Analysis System). Zur Analyse einer Beispielsequenz wollen wir einige Programme dieses Instituts nutzen. Alle aufgeführten Programme sind auch auf dem Expasy-Server zu finden. Dort finden sich unter den einzelnen Rubriken weitere Programme sowie Untersuchungsmethoden für spezielle Fragestellungen (z. B. Glycoproteine, Transmembranproteine). Ausgehend von einer Aminosäure-Sequenz wollen wir die mögliche Raumstruktur erkunden (Online-Dienste-Sammlung).

Beispiel

Das unbekannte Protein sei: MNTQLMGERIRARRKKLKIRQAALATKAGVLSTTVSIERNLQTNPSSETTEPNGENLLALSKALQCSPDYLLKGDLSGNVAY

Das Ergebnis von vier Recherchen wird in den folgenden Abschnitten dargestellt:

  1. Sequenzhomologie: Suche nach identischen oder ähnlichen Sequenzen innerhalb der internationalen Datenbanken.
  2. Chemische Parameter: Parameter wie Gesamtladung, molekulare Masse o.ä.: lokale Rechenprogramme.
  3. Sekundärstrukturvorhersage nach zumeist mehreren Methoden.
  4. Tertiärstruktur: Aufgrund einer immer größeren Anzahl von Proteinstrukturen gelingt immer häufiger eine eindeutige Zuordnung, sobald die 3D-Struktur charakteristische Merkmale enthält (BLAST und PDB).
Seite 21 von 27